PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_8BAA498F1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 403aa    MW: 47395.3 Da    PI: 8.7235
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_8BAA498F1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR122.73.3e-072355791
                   FAR1 57 etrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                           ++r++Cka +k+kk+  ++w  +k+ leHnH+l+p
  Traes_5BL_8BAA498F1.1  2 SKRVNCKAAVKMKKK-GKEWIYEKVLLEHNHTLNP 35
                           79************9.9***************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-4235IPR004330FAR1 DNA binding domain
PfamPF105518.8E-32156248IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MSKRVNCKAA VKMKKKGKEW IYEKVLLEHN HTLNPEPWEL KHMHSHKNKD PAIMEFLDDL  60
QMCDVSPNAT MNVLTKMHGN RENMPWSERD LQNRKAENVR KERADDVKKL KAFFNECRAQ  120
NSKFYYDIEH DSEGAPKNIF WSHASCQANY AEFGDVVTFD TTYKCNFYNK PLAMFVGSNH  180
HLQNVIFGFA LLGDEKEETF DWVFRTFKMC MENKEPHCIL TDQDQAMANA LPGVFPNTIH  240
RLCRWHVLHG HKDSLKVLYN LYDGLKEKLL TIINHPLTPM EFEKAWMEMV NEYGLESDPT  300
IGSLYDLRTR WIAAYFKDVY CGKMTSTQRS ESTNRIVKRN HINPTTPLHV FARKMFQVLQ  360
GRKEAEARVT MESQARPKTV TNYPLEHQLS RIYTHAVFRK YKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239771.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5FEJ00.0W5FEJ0_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-63FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]